PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10014093m
Common NameCARUB_v10014093mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 347aa    MW: 38869.4 Da    PI: 6.1777
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10014093mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.1e-153279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  Carubv10014093m 32 KGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYL 79
                     678*****************************99************97 PP

2Myb_DNA-binding48.12.7e-1585129147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+ +++  lG++ W+ Ia +++ gRt++++k++w++ 
  Carubv10014093m  85 RGSFSPQEEDLIFHLHSILGNR-WSQIATRLP-GRTDNEIKNFWNST 129
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-222682IPR009057Homeodomain-like
PROSITE profilePS5129417.3092779IPR017930Myb domain
SuperFamilySSF466891.19E-2729126IPR009057Homeodomain-like
SMARTSM007171.7E-123181IPR001005SANT/Myb domain
PfamPF002496.7E-143279IPR001005SANT/Myb domain
CDDcd001672.85E-103579No hitNo description
PROSITE profilePS5129424.98480134IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2583135IPR009057Homeodomain-like
SMARTSM007171.4E-1584132IPR001005SANT/Myb domain
PfamPF002494.4E-1485129IPR001005SANT/Myb domain
CDDcd001677.17E-1187130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MMMRKPDITT TRDKGKPNHA CGGNNNKPKL RKGLWSPDED EKLIRYMLTN GQGCWSDIAR  60
NAGLLRCGKS CRLRWINYLR PDLKRGSFSP QEEDLIFHLH SILGNRWSQI ATRLPGRTDN  120
EIKNFWNSTL KKRLKNNNNN TSSGSSPNNS NSNSMDPRDL HVDMAGGNST PMIDGYHHHD  180
DNMIIVGNTM SMESSSSFNF APMVNSVGLN QLDDPLMISS LPDNRYHQMG NTGNVFNVNG  240
LEDYGNTILD QASKRVSVEG DHWFLPPSEG TNIIACSTSN NNLNLQVLDP CFNSKNICHA  300
ESFKVGNMLG MENGEWEIEN PKIGDWDLDG LIDNNSSFPF LDFQVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-292813423128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936060.0AB493606.1 Arabidopsis thaliana At3g08500 mRNA for hypothetical protein, partial cds, clone: RAAt3g08500.
GenBankAF3719740.0AF371974.1 Arabidopsis thaliana putative transcription factor MYB83 (MYB83) mRNA, complete cds.
GenBankBT0265060.0BT026506.1 Arabidopsis thaliana At3g08500 mRNA, complete cds.
GenBankDQ4466450.0DQ446645.1 Arabidopsis thaliana clone pENTR221-At3g08500 myb family transcription factor (At3g08500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298049.10.0hypothetical protein CARUB_v10014093mg
TrEMBLR0G5W80.0R0G5W8_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__848__AT3G08500.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.10.0myb domain protein 83